Lixisenatide
Short-acting prandial GLP-1 receptor agonist for postprandial glucose control
Written by Michael Carroll — Owner, Director of Research · Reviewed by the Peptide Initiative Research Team · Editorial standards
Suggested dose
10 – 20 mcg
10 mcg
Days 1-14
20 mcg
From day 15 onward
Compound profile
Lixisenatide scientific & efficacy data
Weight Management
Peptide profile
Strong human trials
Lixisenatide
10 mcg · Once daily
Molecular formula
C215H347N61O65S
- Mol. weight
- 4,858 Da
- CAS number
- 320367-13-3
- PubChem
- 90472060
- Developed · 2016 (FDA approval)
- Sanofi Research Team
Sanofi
Amino acid sequence
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKKBlood Sugar Control
Powerful postprandial glucose reduction through GLP-1 receptor activation, delayed gastric emptying, and glucose-dependent insulin secretion
Cardiovascular Safety
Demonstrated cardiovascular safety in the ELIXA trial with no increased risk of major adverse cardiovascular events
Weight Management
Modest weight reduction through appetite suppression and delayed gastric emptying, though less pronounced than long-acting GLP-1 RAs
Dosing
How much Lixisenatide do I take?
10 mcg, titrated to 20 mcg · once daily
10 – 20 mcg
Once daily
Covers all 2 documented dose levels · timing · dose-adjustment guidance.
Every documented dose level
| Phase | Dose | Frequency |
|---|---|---|
| Weeks 1-2 | 10 mcg | Once daily |
| Day 15 | 20 mcg | Once daily |
Suitability
Is Lixisenatide right for me?
Best for managing postprandial hyperglycemia in type 2 diabetes & improving glycemic control as add-on to oral antidiabetics
Best for
Managing postprandial hyperglycemia in type 2 diabetes
Lixisenatide is particularly well-suited for individuals focused on managing postprandial hyperglycemia in type 2 diabetes. Research and clinical experience suggest meaningful benefits in this area when used as part of a comprehensive treatment approach.
Improving glycemic control as add-on to oral antidiabetics
Lixisenatide is particularly well-suited for individuals focused on improving glycemic control as add-on to oral antidiabetics. Research and clinical experience suggest meaningful benefits in this area when used as part of a comprehensive treatment approach.
Supporting weight management in T2DM patients
Lixisenatide is particularly well-suited for individuals focused on supporting weight management in t2dm patients. Research and clinical experience suggest meaningful benefits in this area when used as part of a comprehensive treatment approach.
Combination therapy with basal insulin glargine
Lixisenatide is particularly well-suited for individuals focused on combination therapy with basal insulin glargine. Research and clinical experience suggest meaningful benefits in this area when used as part of a comprehensive treatment approach.
Consider alternatives if
Do not use if
Use with caution if
Not sure?
Compare Lixisenatide with similar peptides to find the best fit for your goals.
Administration
How do I use Lixisenatide?
subcutaneous injection
Route
Subcutaneous injection (into the fatty tissue just under the skin)—allows for consistent absorption and can be self-administered at home after proper training
Best sites
Covers reconstitution · step-by-step technique · storage · a sample daily schedule.
Safety
Is Lixisenatide safe?
4 common side effects · 2 serious
Lixisenatide (ADLYXIN in the US, Lyxumia in the EU) is an FDA-approved GLP-1 receptor agonist for type 2 diabetes; its safety record comes from the GetGoal phase 3 trials and the ELIXA cardiovascular outcomes trial.
[1][6] In the pooled placebo-controlled trials, gastrointestinal reactions affected 39.7% of patients against 18.4% on placebo, mostly in the first 3 weeks; nausea affected 25% and vomiting 10%.
[6] Labelled warnings cover anaphylaxis and serious hypersensitivity, pancreatitis (21 cases on lixisenatide against 14 on comparators), hypoglycemia when combined with a sulfonylurea or basal insulin, acute kidney injury after severe GI fluid loss, antibody formation and gallbladder disease.
[6] Unlike the long-acting GLP-1 agonists, its label carries no boxed thyroid C-cell tumor warning. [6]
Across the GetGoal trials, lixisenatide 20 mcg once daily lowered HbA1c by 0.46–0.99% and 2-hour post-meal glucose by 56–143 mg/dL, with weight change from −2.96 to +0.3 kg; severe hypoglycemia was under 1.5%.
[1] In ELIXA, 6,068 patients with type 2 diabetes and a recent acute coronary syndrome were followed for a median of about 26 months; major cardiovascular events occurred in 13.4% on lixisenatide against 13.2% on placebo (hazard ratio 1.02, 95% CI 0.89–1.17), meeting non-inferiority.
[6] In the trials, 70% of patients developed anti-lixisenatide antibodies by week 24, and the 2.4% with the highest levels had a weaker glucose response. [6]
Less common
These typically resolve with continued use or dose adjustment.
Common side effects · experienced by some users
Nausea
Most frequently reported side effect, affecting 25-28% of patients in clinical trials. Typically mild to moderate and most pronounced during the initial dose-titration period.
Management: Start at 10 mcg for 14 days before increasing to 20 mcg. Take before meals as directed. Symptoms typically diminish within the first 2-4 weeks of treatment.
Vomiting
Occurs in approximately 10% of patients, usually in conjunction with nausea during early treatment. Related to GLP-1 receptor-mediated gastric emptying delay.
Management: Eat smaller meals, avoid high-fat foods during initiation. Ensure adequate hydration. If persistent, consult prescriber about temporary dose reduction.
Diarrhea
Reported in 7-8% of patients. Usually transient and related to changes in gastrointestinal motility from GLP-1 receptor activation in the gut.
Management: Maintain hydration and balanced diet. Symptoms typically resolve without intervention. If severe or persistent, contact healthcare provider.
Headache
Mild headaches reported in approximately 9% of patients. May be related to metabolic changes during early treatment with GLP-1 receptor agonists.
Management: Usually resolves with continued use. Standard analgesics may be used for relief. Ensure adequate hydration and consistent meal timing.
Stop and seek help if
- Severe or worsening side effects that don't improve with dose adjustment or supportive care
- Signs of an allergic reaction—rash, hives, swelling, or difficulty breathing
- Your healthcare provider recommends discontinuation based on your clinical response
- Development of any new medical condition that may be contraindicated with Lixisenatide
- Pregnancy or planning to become pregnant (unless specifically approved for use during pregnancy)
- Abnormal lab results or clinical markers that suggest adverse effects
Lixisenatide should only be started, adjusted, or discontinued under medical supervision. This information is for educational purposes only and does not replace professional medical advice. Never stop a prescribed treatment without consulting your healthcare provider first, as abrupt discontinuation may have consequences.
With other peptides
- Safe:Insulin Glargine — FDA-approved fixed-ratio combination (Soliqua 100/33) for complementary fasting and postprandial glucose control
- Safe:Metformin — First-line combination providing complementary mechanisms for glycemic control and insulin sensitization
- Safe:SGLT2 Inhibitors — Complementary glucose-lowering via insulin-independent renal glucose excretion with added cardiorenal benefits
With medications
- Caution:Other GLP-1 Receptor Agonists — Redundant mechanism of action with increased gastrointestinal side effects and no additional benefit
- Caution:DPP-4 Inhibitors — Overlapping incretin pathway stimulation provides minimal additional glucose-lowering effect
- Caution:Time-sensitive oral medications — Lixisenatide delays gastric emptying. Take antibiotics and acetaminophen at least 1 hour before the injection, and oral contraceptives at least 1 hour before or 11 hours after it [6]
With supplements
- Safe:Multivitamins — Generally safe to take alongside Lixisenatide. Space doses apart if taking oral formulations to ensure optimal absorption.
- Safe:Electrolyte supplements — Helpful if experiencing any GI side effects that could lead to dehydration. Safe to combine.
Effectiveness
How do I know Lixisenatide is working?
Strong human trials · first signs weeks 1-2
Evidence level
Strong human trials
(Phase 3 or FDA approved)
Regulatory status
FDA approved for this use
Onset of effects
Moderate
(1-2 weeks)
How it works
Lixisenatide is a once-daily GLP-1 hormone that helps control blood sugar in people with type 2 diabetes by increasing insulin release, suppressing glucagon, and slowing stomach emptying to reduce appetite.
The deeper mechanism
Lixisenatide is a synthetic 44-amino-acid GLP-1 receptor agonist, amidated at its C-terminus, with a molecular weight of about 4.86 kDa. [6] It increases glucose-dependent insulin release, lowers glucagon secretion and slows gastric emptying.
[6] Its mean terminal half-life is about 3 hours, and it is cleared by glomerular filtration and proteolytic breakdown.
[6] Because it is short-acting, its main effect is on the meal that follows the injection: in a clinical pharmacology study it lowered post-meal glucose most after the first meal of the day, with a weaker effect at later meals.
[6] Lixisenatide slowed gastric emptying more than liraglutide in a head-to-head trial. [3]
What to expect
Weeks 1-2
What you might notice
- Initial postprandial glucose improvements, possible nausea as the body adjusts to GLP-1 receptor activation during the 10 mcg starting dose period
What's normal
- Nausea, mild appetite reduction, and slight changes in bowel habits are common during this initiation phase
- Some patients notice reduced hunger after meals within days
What's next
- After 14 days at 10 mcg, dose increases to the full 20 mcg maintenance dose with further glycemic improvement expected
Weeks 3-8
What you might notice
- More consistent postprandial glucose control at the full 20 mcg dose, GI side effects typically diminishing, early weight stabilization or modest loss
What's normal
- Nausea should begin to subside significantly
- Postprandial glucose readings will show improvement
- Fasting glucose may improve modestly
- Weight may begin a gradual downward trend
What's next
- Continue treatment at 20 mcg daily
- HbA1c measurements at 12-16 weeks will reflect the cumulative glycemic benefit
Weeks 12-24
What you might notice
- Full glycemic benefit: in the GetGoal trials HbA1c fell 0.46–0.99% from baseline, with weight change ranging from a 2.96 kg loss to a 0.3 kg gain [1]
- 0%, sustained postprandial glucose improvements, potential weight loss of 1-3 kg
What's normal
- GI side effects should be minimal or resolved
- Glycemic control should be stable
- Weight loss, if occurring, tends to plateau at modest levels compared to long-acting GLP-1 RAs
What's next
- Assess overall treatment response with HbA1c
- If targets not met, consider addition of basal insulin or transition to fixed-ratio combination (Soliqua)
Signs it's working
Treatment Response
- Improvement in the primary symptoms or condition being treated
- Positive changes in relevant lab values or clinical markers
- Consistent, stable response to Lixisenatide over time
- Reduction in symptom frequency or severity
General Well-being
- Improved energy levels and daily functioning
- Better quality of life related to the treated condition
- Manageable or absent side effects indicating good tolerance
- Positive feedback from healthcare provider during check-ups
Not seeing results? Common reasons
- Not at therapeutic dose yet—initial doses are for building tolerance, not maximum effect
- Insufficient time at target dose—most compounds need several weeks to show full benefits
- Inconsistent dosing schedule—regular, consistent use is crucial for optimal results
- Individual variation in response—genetics, metabolism, and other factors affect outcomes
- Underlying conditions or medications interfering with absorption or effectiveness
- Improper storage leading to degraded product—always verify proper storage conditions
Key research
Clinical trials
Lixisenatide tested in people
61 registered studies, 1 still enrolling.
By phase
A trial spanning two phases is counted in both, so these can sum above the total. Observational studies carry no phase.
What kind of research
About 21,458 people took part in the studies that actually administered Lixisenatide. Observational studies analyse the records of people already taking it — nobody was given anything for the study, so they are counted separately and cannot show cause and effect.
Most recent
Using Secondary Data to Evaluate Sex-based Heterogeneity of GLP-1 Agonists and SGLT2 Inhibitors on Cardiovascular-Kidney-Metabolic Health (CKMH) Outcomes in Real-world Settings (DASH-CKMH)
Ohio State University
Evaluation of the Efficacy and Safety of GLP-1 Receptor Agonist Therapy In Steroid-Induced Diabetes
Medical University of Warsaw
Real-World Evaluation of Omarigliptin for Type 2 Diabetes Meliitus in Bangladesh
Bangladesh Institute of Research and Rehabilitation in Diabetes, Endocrine and Metabolic Disorders
Sources: ClinicalTrials.gov, the EU Clinical Trials Information System and ISRCTN, deduplicated so a study registered twice is counted once. A study is counted when Lixisenatide is named as an intervention; studies that only mention it in passing are not.
Questions
Frequently asked about Lixisenatide
How does lixisenatide differ from long-acting GLP-1 agonists like semaglutide or liraglutide?
Lixisenatide is classified as a short-acting GLP-1 receptor agonist with a half-life of about 3 hours, while long-acting agents like semaglutide have half-lives of days to a week. This means lixisenatide primarily targets postprandial (after-meal) glucose through potent gastric emptying delay, whereas long-acting agents provide more continuous GLP-1 receptor activation affecting both fasting and postprandial glucose. Long-acting agents generally produce greater HbA1c reduction and weight loss, but lixisenatide uniquely excels at controlling post-meal glucose spikes.
What is Soliqua and how does it relate to lixisenatide?
Soliqua 100/33 is an FDA-approved fixed-ratio combination of insulin glargine (a long-acting basal insulin) and lixisenatide in a single injection pen. Each unit delivers 1 unit of insulin glargine and 1/3 mcg of lixisenatide. This combination leverages the complementary mechanisms — basal insulin controls fasting glucose while lixisenatide targets postprandial glucose — providing comprehensive glycemic control with less weight gain and hypoglycemia than insulin alone.
What did the ELIXA cardiovascular outcomes trial show?
The ELIXA (Evaluation of Lixisenatide in Acute Coronary Syndrome) trial enrolled 6,068 patients with type 2 diabetes who had a recent acute coronary syndrome event. Over a median follow-up of 25 months, lixisenatide demonstrated cardiovascular safety with a hazard ratio of 1.02 (95% CI: 0.89-1.17) for MACE (major adverse cardiovascular events), meeting its primary noninferiority endpoint. While it did not show cardiovascular superiority, it confirmed that lixisenatide does not increase cardiovascular risk.
When should I take lixisenatide in relation to meals?
Inject lixisenatide subcutaneously in the abdomen, thigh or upper arm within one hour before the first meal of the day, preferably before the same meal each day. [6] If you miss a dose, inject it within one hour before your next meal. [6] Timing matters because its glucose-lowering effect is strongest on the meal that follows the injection. [6]
Can lixisenatide be used in type 1 diabetes?
No, lixisenatide is not approved or recommended for type 1 diabetes. It is specifically indicated for the treatment of type 2 diabetes mellitus as an adjunct to diet and exercise. Type 1 diabetes involves autoimmune destruction of beta cells, and GLP-1 receptor agonists work primarily by enhancing glucose-dependent insulin secretion from functioning beta cells.
Does lixisenatide affect the absorption of other oral medications?
Yes. Lixisenatide delays gastric emptying, which can slow the absorption of oral medications. [6] Take antibiotics, acetaminophen and other drugs that need to reach a threshold level quickly at least 1 hour before the injection. [6] Take oral contraceptives at least 1 hour before or at least 11 hours after it: taken 1–4 hours after a dose, their peak levels fell by up to half in the label's study. [6] Drugs with a narrow therapeutic range should be monitored when lixisenatide is started. [6]
Further reading
Lixisenatide history & related research
History · since 2003
The Mealtime Guardian Built From Lizard DNA
Born from the same Gila monster venom as exenatide but redesigned with a tail of six extra amino acids, lixisenatide found its calling not as a blood sugar workhorse, but as a mealtime specialist — and eventually as half of a powerful combination drug.
Read the full history of LixisenatideStudied for
Ready for the protocol?
Every dosing tier, administration route, timing note, and dose-adjustment rule for Lixisenatide, on one page.